PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.13G077500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family NF-YB
Protein Properties Length: 183aa    MW: 20111.8 Da    PI: 4.7224
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.13G077500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB111.83.8e-356703397
                NF-YB 33 etvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97
                         e   ecvsefisf+t+easdkcq+ekrktingddllwa++tlGfe+yv plkvyl+kyre+egek
  Manes.13G077500.1.p  6 EEGAECVSEFISFITGEASDKCQKEKRKTINGDDLLWAMTTLGFENYVGPLKVYLNKYRETEGEK 70
                         55679**********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PRINTSPR006153.3E-18826No hitNo description
PfamPF008082.1E-12944IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
SuperFamilySSF471131.6E-25981IPR009072Histone-fold
Gene3DG3DSA:1.10.20.107.0E-339100IPR009072Histone-fold
PROSITE patternPS0068501127IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006153.3E-182745No hitNo description
PRINTSPR006153.3E-184664No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MEEEEEEGAE CVSEFISFIT GEASDKCQKE KRKTINGDDL LWAMTTLGFE NYVGPLKVYL  60
NKYRETEGEK NSMARQEDHQ SPPPAAAAGA GGNSSDNHGN EMNKVNGYVS TEVDFQGFNS  120
GFYSLGAQVS RKSSYGENSR FVGYGDHLVD AAASFNMNRK RENGDANNNR PMAAHIHHGV  180
EW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B4e-272652992Transcription factor HapC (Eurofung)
4g92_B4e-272652992Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002306345.22e-74hypothetical protein POPTR_0005s08510g
TrEMBLB9H5A02e-74B9H5A0_POPTR; Uncharacterized protein
STRINGPOPTR_0005s08510.16e-74(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.15e-39nuclear factor Y, subunit B3